PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma1g01820.1
Common NameZOSMA_1G01820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MYB
Protein Properties Length: 1006aa    MW: 111878 Da    PI: 4.9792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma1g01820.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.8e-174793148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+ Ed +l +av+ + g++Wk+Ia+++  +Rt+ qc +rwqk+l
   Zosma1g01820.1 47 KGQWTAAEDAILSKAVQTYKGRNWKKIAECFS-NRTDVQCLHRWQKVL 93
                     799*****************************.************986 PP

2Myb_DNA-binding53.94e-1799145148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+l+ + v  +G + W++Ia+ ++ gR +kqc++rw+++l
   Zosma1g01820.1  99 KGPWSKEEDDLIMEMVIIHGAKKWSLIAQALP-GRIGKQCRERWHNHL 145
                      79******************************.*************97 PP

3Myb_DNA-binding52.51.2e-16151193145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r +WT+eE+++l++a++ +G++ W+   ++++ gRt++ +k++w+
   Zosma1g01820.1 151 REAWTQEEELRLIQAHQVYGNK-WAELTKYLP-GRTDNAIKNHWN 193
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0494293IPR017930Myb domain
SuperFamilySSF466891.15E-1845108IPR009057Homeodomain-like
SMARTSM007172.3E-144695IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2149106IPR009057Homeodomain-like
PfamPF139212.2E-1650108No hitNo description
CDDcd001672.66E-125093No hitNo description
PROSITE profilePS5129431.22894149IPR017930Myb domain
SuperFamilySSF466892.21E-3096192IPR009057Homeodomain-like
SMARTSM007173.3E-1698147IPR001005SANT/Myb domain
CDDcd001672.52E-14101145No hitNo description
Gene3DG3DSA:1.10.10.603.2E-26107152IPR009057Homeodomain-like
PROSITE profilePS5129420.521150200IPR017930Myb domain
SMARTSM007178.7E-15150198IPR001005SANT/Myb domain
PfamPF002491.4E-14151194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-22153200IPR009057Homeodomain-like
CDDcd001672.05E-11153193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1006 aa     Download sequence    Send to blast
MASDRPGTSA TTDDKSNEVS NEPIKDPRPK HKHSQGRTTG PTRRSTKGQW TAAEDAILSK  60
AVQTYKGRNW KKIAECFSNR TDVQCLHRWQ KVLNPNLVKG PWSKEEDDLI MEMVIIHGAK  120
KWSLIAQALP GRIGKQCRER WHNHLNPSIN REAWTQEEEL RLIQAHQVYG NKWAELTKYL  180
PGRTDNAIKN HWNSSVKKKL DFYMSSGLIA QIQSLPDTQN SSHCISSCSE EKQQIIQSQG  240
LTCVDNSNQC ISSFSEVKQQ FNSENGLNEA AEVEESSECT RVSAQLCCSI SDFDGETVPF  300
NENEGLKMEE SSVGQENLQN PQSSFLEEYN NSLEYAKHIF TVEPGIGIPG NTENHESYID  360
VAIPRNMFSQ INPPDVAISS FLDESQHSAG DLSDKTKYSH VSDSNYGNEK LSHLSSRNLN  420
DQISLENSDS IVSQKNGRQM AEGDTCNTHC YTTLPEISSA DLAESSLVIN LDDCTDSSTI  480
CNANQQNTEK SNMPDSTSQP HHPICSSDVC NPSFIYSVNE KLMFENNLGD SMSQLHDSEI  540
PTCDYDEFFN LHSSMIHFSV DGNDDLVDNH LQTMDNTEKQ VLVSNEINML CSEVPNDPAR  600
SHVNSEENTN ACRDYNSEAL CYEPPRFPSI DVPFVSCDLV SSVDLQQAYS PLGIRQLMMS  660
SINCTSPYGL WDSLSCESSP DAVLKNAAKS FLCTPSILKK RQRELLSPLC EKSDRKSGKK  720
INHDLFCAVS NRNDSSSKDA TYNDGRLCDI SYESNKGNFS PDCQKSKSIH SMDQRECFDS  780
SLKQSQDQPI DDKSKSAKVC GDNIIPKDSK LNNPGTLNDV NIDAKTETKL DGIVIENDIG  840
NPSISTHAPE GPEPKKRFTD TPGIKRGIES PSAWKSPWFL RAFEDMGYLL SPIDKTYDAI  900
GLMRHLSEHN AVALTDCHEI LRGGNSGRRS IGRCSNLSNS VTRSNLWQDE EKENSQATNI  960
MVECRVLDFS GCGSSPSKEA MGGSKKADDV ENSYKSPPCH TKCLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-61472006159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-61472006159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PMN30.0A0A0K9PMN3_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.21e-157Homeodomain-like protein